Human B2M/IMD43 ORF/cDNA clone-Lentivirus plasmid (NM_004048)

Cat. No.: pGMLP000539
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human B2M/IMD43 Lentiviral expression plasmid for B2M lentivirus packaging, B2M lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to B2M/Beta-2-Microglobulin/B2M/IMD43 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000539
Gene Name B2M
Accession Number NM_004048
Gene ID 567
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 360 bp
Gene Alias IMD43
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCTCGCTCCGTGGCCTTAGCTGTGCTCGCGCTACTCTCTCTTTCTGGCCTGGAGGCTATCCAGCGTACTCCAAAGATTCAGGTTTACTCACGTCATCCAGCAGAGAATGGAAAGTCAAATTTCCTGAATTGCTATGTGTCTGGGTTTCATCCATCCGACATTGAAGTTGACTTACTGAAGAATGGAGAGAGAATTGAAAAAGTGGAGCATTCAGACTTGTCTTTCAGCAAGGACTGGTCTTTCTATCTCTTGTACTACACTGAATTCACCCCCACTGAAAAAGATGAGTATGCCTGCCGTGTGAACCATGTGACTTTGTCACAGCCCAAGATAGTTAAGTGGGATCGAGACATGTAA
ORF Protein Sequence MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T58080-Ab Anti-B2MG/ B2M/ IMD43 monoclonal antibody
    Target Antigen GM-Tg-g-T58080-Ag B2M VLP (virus-like particle)
    ORF Viral Vector pGMLP000539 Human B2M Lentivirus plasmid
    ORF Viral Vector pGMLV002489 Human B2M Lentivirus plasmid
    ORF Viral Vector pGMAP000411 Human B2M Adenovirus plasmid
    ORF Viral Vector vGMLP000539 Human B2M Lentivirus particle
    ORF Viral Vector vGMLV002489 Human B2M Lentivirus particle
    ORF Viral Vector vGMAP000411 Human B2M Adenovirus particle


    Target information

    Target ID GM-T58080
    Target Name B2M/Beta-2-Microglobulin
    Gene Group Identifier
    （Target Gene ID in Homo species)         		567
    Gene ID 100034203 (Equus caballus), 100855741 (Canis lupus familiaris), 12010 (Mus musculus), 24223 (Rattus norvegicus)
    494145 (Felis catus), 567 (Homo sapiens), 712428 (Macaca mulatta)
    Gene Symbols & Synonyms B2M,B2m,Ly-m11,beta2m,beta2-m,IMD43,AMYLD6,MHC1D4
    Target Alternative Names AMYLD6,B2M,B2m,Beta-2-Microglobulin,Beta-2-microglobulin,IMD43,Ly-m11,MHC1D4,beta2-m,beta2m
    Uniprot Accession P01887,P07151,P19341,P30441,P61769,Q5MGS7,Q6V7J5
    Additional SwissProt Accessions: P30441,P19341,P01887,P07151,Q5MGS7,P61769,Q6V7J5
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Diagnostics Biomarker
    Disease cancer, Ovary Cancer, Urinary tract obstruction, Malignant neoplasm of prostate, Congenital occlusion of ureteropelvic junction, Acute kidney failure, Asphyxia neonatorum, Autosomal Dominant Polycystic Kidney Disease, Balkan nephropathy, Bronchopulmonary Dysplasia, Dent disease, Kidney transplant rejection, lymphomas, Malignant neoplasm of colon, Nephropathy induced by other drugs, medicaments and biological substances, Nephrotic syndrome, Proteinuria, Renal fibrosis, Peripheral T-cell lymphomas (PTCL)
    Disease from KEGG Antigen processing and presentation, Human cytomegalovirus infection, Human T-cell leukemia virus 1 infection, Epstein-Barr virus infection
    Gene Ensembl ENSMUSG00000060802, ENSG00000166710, ENSMMUG00000060797
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.