Human PRTN3/ACPA/AGP7 ORF/cDNA clone-Lentivirus plasmid (NM_002777)

Cat. No.: pGMLP000548
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PRTN3/ACPA/AGP7 Lentiviral expression plasmid for PRTN3 lentivirus packaging, PRTN3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to PRTN3/ACPA products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $492.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000548
Gene Name PRTN3
Accession Number NM_002777
Gene ID 5657
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 771 bp
Gene Alias ACPA,AGP7,C-ANCA,CANCA,MBN,MBT,NP-4,NP4,P29,PR-3,PR3
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTCACCGGCCCCCCAGCCCTGCCCTGGCGTCCGTGCTGCTGGCCTTGCTGCTGAGCGGTGCTGCCCGAGCTGCGGAGATCGTGGGCGGGCACGAGGCGCAGCCACACTCCCGGCCCTACATGGCCTCCCTGCAGATGCGGGGGAACCCGGGCAGCCACTTCTGCGGAGGCACCTTGATCCACCCCAGCTTCGTGCTGACGGCCGCGCACTGCCTGCGGGACATACCCCAGCGCCTGGTGAACGTGGTGCTCGGAGCCCACAACGTGCGGACGCAGGAGCCCACCCAGCAGCACTTCTCGGTGGCTCAGGTGTTTCTGAACAACTACGACGCGGAGAACAAACTGAACGACGTTCTCCTCATCCAGCTGAGCAGCCCAGCCAACCTCAGTGCCTCCGTCGCCACAGTCCAGCTGCCACAGCAGGACCAGCCAGTGCCCCACGGCACCCAGTGCCTGGCCATGGGCTGGGGCCGCGTGGGTGCCCACGACCCCCCAGCCCAGGTCCTGCAGGAGCTCAATGTCACCGTGGTCACCTTCTTCTGCCGGCCACATAACATTTGCACTTTCGTCCCTCGCCGCAAGGCCGGCATCTGCTTCGGAGACTCAGGTGGCCCCCTGATCTGTGATGGCATCATCCAAGGAATAGACTCCTTCGTGATCTGGGGATGTGCCACCCGCCTTTTCCCTGACTTCTTCACGCGGGTAGCCCTCTACGTGGACTGGATCCGTTCCACGCTGCGCCGTGTGGAGGCCAAGGGCCGCCCCTGA
ORF Protein Sequence MAHRPPSPALASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRRVEAKGRP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T15882-Ab Anti-PRTN3/ ACPA/ AGP7 monoclonal antibody
    Target Antigen GM-Tg-g-T15882-Ag PRTN3 VLP (virus-like particle)
    ORF Viral Vector pGMLP000548 Human PRTN3 Lentivirus plasmid
    ORF Viral Vector pGMAP000488 Human PRTN3 Adenovirus plasmid
    ORF Viral Vector vGMLP000548 Human PRTN3 Lentivirus particle
    ORF Viral Vector vGMAP000488 Human PRTN3 Adenovirus particle


    Target information

    Target ID GM-T15882
    Target Name PRTN3
    Gene Group Identifier
    (Target Gene ID in Homo species)
    5657
    Gene ID 100147215 (Equus caballus), 100298591 (Bos taurus), 19152 (Mus musculus), 314615 (Rattus norvegicus)
    5657 (Homo sapiens), 721131 (Macaca mulatta)
    Gene Symbols & Synonyms PRTN3,Prtn3,PR3,PR-3,mPR3,MBN,MBT,NP4,P29,ACPA,AGP7,NP-4,CANCA,C-ANCA
    Target Alternative Names ACPA,AGP7,C-ANCA,C-ANCA antigen,CANCA,Leukocyte proteinase 3 (PR-3,MBN,MBT,Myeloblastin,NP-4,NP4,Neutrophil proteinase 4 (NP-4),P29,PR-3,PR3,PR3),PRTN3,Prtn3,Wegener autoantigen,mPR3
    Uniprot Accession P24158,Q61096
    Additional SwissProt Accessions: Q61096,P24158
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target
    Disease cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000040021, ENSBTAG00000046105, ENSMUSG00000057729, ENSG00000196415
    Target Classification Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.