Human MUC1/ADMCKD/ADMCKD1 ORF/cDNA clone-Lentivirus plasmid (NM_001018016)

Cat. No.: pGMLP000558
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MUC1/ADMCKD/ADMCKD1 Lentiviral expression plasmid for MUC1 lentivirus packaging, MUC1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to MUC1/CA15-3/CA15-3 C-terminal/CD227/MUC1/ADMCKD products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $498.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000558
Gene Name MUC1
Accession Number NM_001018016
Gene ID 4582
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 795 bp
Gene Alias ADMCKD,ADMCKD1,CA 15-3,CD227,EMA,H23AG,KL-6,MAM6,MCD,MCKD,MCKD1,MUC-1,MUC-1/SEC,MUC-1/X,MUC1/ZD,PEM,PEMT,PUM
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACACCGGGCACCCAGTCTCCTTTCTTCCTGCTGCTGCTCCTCACAGTGCTTACAGCTACCACAGCCCCTAAACCCGCAACAGTTGTTACGGGTTCTGGTCATGCAAGCTCTACCCCAGGTGGAGAAAAGGAGACTTCGGCTACCCAGAGAAGTTCAGTGCCCAGCTCTACTGAGAAGAATGCTTTTAATTCCTCTCTGGAAGATCCCAGCACCGACTACTACCAAGAGCTGCAGAGAGACATTTCTGAAATGTTTTTGCAGATTTATAAACAAGGGGGTTTTCTGGGCCTCTCCAATATTAAGTTCAGGCCAGGATCTGTGGTGGTACAATTGACTCTGGCCTTCCGAGAAGGTACCATCAATGTCCACGACGTGGAGACACAGTTCAATCAGTATAAAACGGAAGCAGCCTCTCGATATAACCTGACGATCTCAGACGTCAGCGTGAGTGATGTGCCATTTCCTTTCTCTGCCCAGTCTGGGGCTGGGGTGCCAGGCTGGGGCATCGCGCTGCTGGTGCTGGTCTGTGTTCTGGTTGCGCTGGCCATTGTCTATCTCATTGCCTTGGCTGTCTGTCAGTGCCGCCGAAAGAACTACGGGCAGCTGGACATCTTTCCAGCCCGGGATACCTACCATCCTATGAGCGAGTACCCCACCTACCACACCCATGGGCGCTATGTGCCCCCTAGCAGTACCGATCGTAGCCCCTATGAGAAGGTTTCTGCAGGTAATGGTGGCAGCAGCCTCTCTTACACAAACCCAGCAGTGGCAGCCACTTCTGCCAACTTGTAG
ORF Protein Sequence MTPGTQSPFFLLLLLTVLTATTAPKPATVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-INN-770 Pre-Made Cantuzumab Ravtansine Biosimilar, Whole Mab Adc, Anti-Muc1 Antibody: Anti-ADMCKD/ADMCKD1/ADTKD2/CA 15-3/CD227/Ca15-3/EMA/H23AG/KL-6/MAM6/MCD/MCKD/MCKD1/SEC/X/ZD/PEM/PEMT/PUM therapeutic antibody Drug Conjugate
    Biosimilar GMP-Bios-INN-1052 Pre-Made Yttrium (90Y) Clivatuzumab Tetraxetan Biosimilar, Radiolabelled Antibody, Anti-Muc1 Antibody: Anti-ADMCKD/ADMCKD1/ADTKD2/CA 15-3/CD227/Ca15-3/EMA/H23AG/KL-6/MAM6/MCD/MCKD/MCKD1/SEC/X/ZD/PEM/PEMT/PUM therapeutic antibody
    Biosimilar GMP-Bios-INN-769 Pre-Made Cantuzumab Mertansine Biosimilar, Whole Mab Adc, Anti-Muc1 Antibody: Anti-ADMCKD/ADMCKD1/ADTKD2/CA 15-3/CD227/Ca15-3/EMA/H23AG/KL-6/MAM6/MCD/MCKD/MCKD1/SEC/X/ZD/PEM/PEMT/PUM therapeutic antibody Drug Conjugate
    Biosimilar GMP-Bios-INN-997 Pre-Made Sontuzumab Biosimilar, Whole Mab, Anti-Muc1 Antibody: Anti-ADMCKD/ADMCKD1/ADTKD2/CA 15-3/CD227/Ca15-3/EMA/H23AG/KL-6/MAM6/MCD/MCKD/MCKD1/SEC/X/ZD/PEM/PEMT/PUM therapeutic antibody
    Biosimilar GMP-Bios-ab-236 Pre-Made Gatipotuzumab biosimilar, Whole mAb, Anti-MUC1 Antibody: Anti-ADMCKD/ADMCKD1/ADTKD2/CA 15-3/CD227/Ca15-3/EMA/H23AG/KL-6/MAM6/MCD/MCKD/MCKD1/SEC/X/ZD/PEM/PEMT/PUM therapeutic antibody
    Biosimilar GMP-Bios-ab-112 Pre-Made Clivatuzumab biosimilar, Whole mAb Radiolabelled, Anti-MUC1 Antibody: Anti-ADMCKD/ADMCKD1/ADTKD2/CA 15-3/CD227/Ca15-3/EMA/H23AG/KL-6/MAM6/MCD/MCKD/MCKD1/SEC/X/ZD/PEM/PEMT/PUM therapeutic antibody
    Biosimilar GMP-Bios-ab-092 Pre-Made Cantuzumab biosimilar, Whole mAb ADC, Anti-MUC1 Antibody: Anti-ADMCKD/ADMCKD1/ADTKD2/CA 15-3/CD227/Ca15-3/EMA/H23AG/KL-6/MAM6/MCD/MCKD/MCKD1/SEC/X/ZD/PEM/PEMT/PUM therapeutic antibody
    Biosimilar GMP-Bios-INN-922 Pre-Made Nacolomab Tafenatox biosimilar, Fusion Protein, Nacolomab-Anti-MUC1 Antibody: Anti-ADMCKD/ADMCKD1/ADTKD2/CA 15-3/CD227/Ca15-3/EMA/H23AG/KL-6/MAM6/MCD/MCKD/MCKD1/SEC/X/ZD/PEM/PEMT/PUM therapeutic antibody fused with Staphylococcus aureus enterotoxin A
    Biosimilar GMP-Bios-INN-784 Pre-Made Clivatuzumab Tetraxetan Biosimilar, Whole Mab Adc, Anti-Muc1 Antibody: Anti-ADMCKD/ADMCKD1/ADTKD2/CA 15-3/CD227/Ca15-3/EMA/H23AG/KL-6/MAM6/MCD/MCKD/MCKD1/SEC/X/ZD/PEM/PEMT/PUM therapeutic antibody Drug Conjugate
    Biosimilar GMP-Bios-ab-426 Pre-Made PankoMab biosimilar, Whole mAb, Anti-MUC1 Antibody: Anti-ADMCKD/ADMCKD1/ADTKD2/CA 15-3/CD227/Ca15-3/EMA/H23AG/KL-6/MAM6/MCD/MCKD/MCKD1/SEC/X/ZD/PEM/PEMT/PUM therapeutic antibody
    Biosimilar GMP-Bios-INN-839 Pre-Made Epitumomab Cituxetan Biosimilar, Radiolabelled Antibody, Anti-Muc1 Antibody: Anti-ADMCKD/ADMCKD1/ADTKD2/CA 15-3/CD227/Ca15-3/EMA/H23AG/KL-6/MAM6/MCD/MCKD/MCKD1/SEC/X/ZD/PEM/PEMT/PUM therapeutic antibody
    Target Antibody GM-Tg-g-T18779-Ab Anti-MUC1/ ADMCKD/ ADMCKD1 monoclonal antibody
    Target Antigen GM-Tg-g-T18779-Ag MUC1 VLP (virus-like particle)
    ORF Viral Vector pGMLP000558 Human MUC1 Lentivirus plasmid
    ORF Viral Vector pGMAD000096 Human MUC1 Adenovirus plasmid
    ORF Viral Vector pGMAD000430 Human MUC1 Adenovirus plasmid
    ORF Viral Vector pGMAP000530 Human MUC1 Adenovirus plasmid
    ORF Viral Vector vGMLP000558 Human MUC1 Lentivirus particle
    ORF Viral Vector vGMAD000096 Human MUC1 Adenovirus particle
    ORF Viral Vector vGMAD000430 Human MUC1 Adenovirus particle
    ORF Viral Vector vGMAP000530 Human MUC1 Adenovirus particle


    Target information

    Target ID GM-T18779
    Target Name MUC1/CA15-3/CA15-3 C-terminal/CD227
    Gene Group Identifier
    (Target Gene ID in Homo species)
    4582
    Gene ID 100063415 (Equus caballus), 101093832 (Felis catus), 17829 (Mus musculus), 24571 (Rattus norvegicus)
    281333 (Bos taurus), 448784 (Canis lupus familiaris), 4582 (Homo sapiens), 717546 (Macaca mulatta)
    Gene Symbols & Synonyms MUC1,Muc1,EMA,CD227,Muc-1,mucin,MCD,PEM,PUM,KL-6,MAM6,MCKD,PEMT,H23AG,MCKD1,MUC-1,ADMCKD,ADTKD2,Ca15-3,ADMCKD1,CA 15-3,MUC-1/X,MUC1/ZD,MUC-1/SEC
    Target Alternative Names ADMCKD,ADMCKD1,ADTKD2,Breast carcinoma-associated antigen DF3,CA 15-3,CA15-3,CA15-3 C-terminal,CD227,Ca15-3,Cancer antigen 15-3 (CA 15-3),Carcinoma-associated mucin,EMA,Episialin,H23AG,KL-6,Krebs von den Lungen-6 (KL-6),MAM6,MCD,MCKD,MCKD1,MUC-1,MUC-1/SEC,MUC-1/X,MUC1,MUC1/ZD,Muc-1,Muc1,Mucin-1,PEM,PEMT,PUM,Peanut-reactive urinary mucin (PUM),Polymorphic epithelial mucin (PEM),Tumor-associated epithelial membrane antigen (EMA),Tumor-associated mucin,mucin
    Uniprot Accession P15941,Q02496,Q8WML4
    Additional SwissProt Accessions: Q02496,Q8WML4,P15941
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target, INN Index
    Disease cancer, Ovary Cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000006646, ENSMUSG00000042784, ENSBTAG00000017104, ENSCAFG00845013058, ENSG00000185499
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.