Human MBL2/COLEC1/HSMBPC ORF/cDNA clone-Lentivirus plasmid (NM_000242)

Cat. No.: pGMLP000559
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MBL2/COLEC1/HSMBPC Lentiviral expression plasmid for MBL2 lentivirus packaging, MBL2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to MBL/MBL2/MBL2/COLEC1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $486.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000559
Gene Name MBL2
Accession Number NM_000242
Gene ID 4153
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 747 bp
Gene Alias COLEC1,HSMBPC,MBL,MBL2D,MBP,MBP-C,MBP1,MBPD
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCCCTGTTTCCATCACTCCCTCTCCTTCTCCTGAGTATGGTGGCAGCGTCTTACTCAGAAACTGTGACCTGTGAGGATGCCCAAAAGACCTGCCCTGCAGTGATTGCCTGTAGCTCTCCAGGCATCAACGGCTTCCCAGGCAAAGATGGGCGTGATGGCACCAAGGGAGAAAAGGGGGAACCAGGCCAAGGGCTCAGAGGCTTACAGGGCCCCCCTGGAAAGTTGGGGCCTCCAGGAAATCCAGGGCCTTCTGGGTCACCAGGACCAAAGGGCCAAAAAGGAGACCCTGGAAAAAGTCCGGATGGTGATAGTAGCCTGGCTGCCTCAGAAAGAAAAGCTCTGCAAACAGAAATGGCACGTATCAAAAAGTGGCTCACCTTCTCTCTGGGCAAACAAGTTGGGAACAAGTTCTTCCTGACCAATGGTGAAATAATGACCTTTGAAAAAGTGAAGGCCTTGTGTGTCAAGTTCCAGGCCTCTGTGGCCACCCCCAGGAATGCTGCAGAGAATGGAGCCATTCAGAATCTCATCAAGGAGGAAGCCTTCCTGGGCATCACTGATGAGAAGACAGAAGGGCAGTTTGTGGATCTGACAGGAAATAGACTGACCTACACAAACTGGAACGAGGGTGAACCCAACAATGCTGGTTCTGATGAAGATTGTGTATTGCTACTGAAAAATGGCCAGTGGAATGACGTCCCCTGCTCCACCTCCCATCTGGCCGTCTGTGAGTTCCCTATCTGA
ORF Protein Sequence MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T32699-Ab Anti-MBL2/ COLEC1/ HSMBPC functional antibody
    Target Antigen GM-Tg-g-T32699-Ag MBL2 protein
    ORF Viral Vector pGMLP000559 Human MBL2 Lentivirus plasmid
    ORF Viral Vector pGMAP000529 Human MBL2 Adenovirus plasmid
    ORF Viral Vector vGMLP000559 Human MBL2 Lentivirus particle
    ORF Viral Vector vGMAP000529 Human MBL2 Adenovirus particle


    Target information

    Target ID GM-T32699
    Target Name MBL/MBL2
    Gene Group Identifier
    （Target Gene ID in Homo species)         		4153
    Gene ID 100034103 (Equus caballus), 101100840 (Felis catus), 17195 (Mus musculus), 281297 (Bos taurus)
    4153 (Homo sapiens), 64668 (Rattus norvegicus), 702652 (Macaca mulatta)
    Gene Symbols & Synonyms MBL2,MBL1,Mbl2,MBL,L-MBP,MBL-C,MBP-C,RARF/P28A,MBP,MBP1,MBPD,MBL2D,COLEC1,HSMBPC,Ab2-001,Ab2-011
    Target Alternative Names Ab2-001,Ab2-011,COLEC1,Collectin-1,HSMBPC,L-MBP,MBL,MBL-C,MBL1,MBL2,MBL2D,MBP,MBP-C,MBP1,MBPD,Mannan-binding protein,Mannose-binding lectin,Mannose-binding protein C,Mbl2,RARF/P28A
    Uniprot Accession O02659,P08661,P11226,P41317
    Additional SwissProt Accessions: P41317,O02659,P11226,P08661
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG Phagosome, Complement and coagulation cascades, Staphylococcus aureus infection
    Gene Ensembl ENSECAG00000018357, ENSMUSG00000024863, ENSBTAG00000007049, ENSG00000165471, ENSMMUG00000046929
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.