Human MBL2/COLEC1/HSMBPC ORF/cDNA clone-Lentivirus plasmid (NM_000242)
Cat. No.: pGMLP000559
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human MBL2/COLEC1/HSMBPC Lentiviral expression plasmid for MBL2 lentivirus packaging, MBL2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
MBL/MBL2/MBL2/COLEC1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP000559 |
| Gene Name | MBL2 |
| Accession Number | NM_000242 |
| Gene ID | 4153 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 747 bp |
| Gene Alias | COLEC1,HSMBPC,MBL,MBL2D,MBP,MBP-C,MBP1,MBPD |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTCCCTGTTTCCATCACTCCCTCTCCTTCTCCTGAGTATGGTGGCAGCGTCTTACTCAGAAACTGTGACCTGTGAGGATGCCCAAAAGACCTGCCCTGCAGTGATTGCCTGTAGCTCTCCAGGCATCAACGGCTTCCCAGGCAAAGATGGGCGTGATGGCACCAAGGGAGAAAAGGGGGAACCAGGCCAAGGGCTCAGAGGCTTACAGGGCCCCCCTGGAAAGTTGGGGCCTCCAGGAAATCCAGGGCCTTCTGGGTCACCAGGACCAAAGGGCCAAAAAGGAGACCCTGGAAAAAGTCCGGATGGTGATAGTAGCCTGGCTGCCTCAGAAAGAAAAGCTCTGCAAACAGAAATGGCACGTATCAAAAAGTGGCTCACCTTCTCTCTGGGCAAACAAGTTGGGAACAAGTTCTTCCTGACCAATGGTGAAATAATGACCTTTGAAAAAGTGAAGGCCTTGTGTGTCAAGTTCCAGGCCTCTGTGGCCACCCCCAGGAATGCTGCAGAGAATGGAGCCATTCAGAATCTCATCAAGGAGGAAGCCTTCCTGGGCATCACTGATGAGAAGACAGAAGGGCAGTTTGTGGATCTGACAGGAAATAGACTGACCTACACAAACTGGAACGAGGGTGAACCCAACAATGCTGGTTCTGATGAAGATTGTGTATTGCTACTGAAAAATGGCCAGTGGAATGACGTCCCCTGCTCCACCTCCCATCTGGCCGTCTGTGAGTTCCCTATCTGA |
| ORF Protein Sequence | MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T32699-Ab | Anti-MBL2/ COLEC1/ HSMBPC functional antibody |
| Target Antigen | GM-Tg-g-T32699-Ag | MBL2 protein |
| ORF Viral Vector | pGMLP000559 | Human MBL2 Lentivirus plasmid |
| ORF Viral Vector | pGMAP000529 | Human MBL2 Adenovirus plasmid |
| ORF Viral Vector | vGMLP000559 | Human MBL2 Lentivirus particle |
| ORF Viral Vector | vGMAP000529 | Human MBL2 Adenovirus particle |
Target information
| Target ID | GM-T32699 |
| Target Name | MBL/MBL2 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
4153 |
| Gene ID |
100034103 (Equus caballus), 101100840 (Felis catus), 17195 (Mus musculus), 281297 (Bos taurus) 4153 (Homo sapiens), 64668 (Rattus norvegicus), 702652 (Macaca mulatta) |
| Gene Symbols & Synonyms | MBL2,MBL1,Mbl2,MBL,L-MBP,MBL-C,MBP-C,RARF/P28A,MBP,MBP1,MBPD,MBL2D,COLEC1,HSMBPC,Ab2-001,Ab2-011 |
| Target Alternative Names | Ab2-001,Ab2-011,COLEC1,Collectin-1,HSMBPC,L-MBP,MBL,MBL-C,MBL1,MBL2,MBL2D,MBP,MBP-C,MBP1,MBPD,Mannan-binding protein,Mannose-binding lectin,Mannose-binding protein C,Mbl2,RARF/P28A |
| Uniprot Accession |
O02659,P08661,P11226,P41317
Additional SwissProt Accessions: P41317,O02659,P11226,P08661 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target |
| Disease | cancer |
| Disease from KEGG | Phagosome, Complement and coagulation cascades, Staphylococcus aureus infection |
| Gene Ensembl | ENSECAG00000018357, ENSMUSG00000024863, ENSBTAG00000007049, ENSG00000165471, ENSMMUG00000046929 |
| Target Classification | Tumor-associated antigen (TAA) |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


