Human IL32/IL-32alpha/IL-32beta ORF/cDNA clone-Lentivirus plasmid (NM_001308078)

Cat. No.: pGMLP000562
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IL32/IL-32alpha/IL-32beta Lentiviral expression plasmid for IL32 lentivirus packaging, IL32 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to IL-32/IL32/IL32/IL-32alpha products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $476.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000562
Gene Name IL32
Accession Number NM_001308078
Gene ID 9235
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 705 bp
Gene Alias IL-32alpha,IL-32beta,IL-32delta,IL-32gamma,NK4,TAIF,TAIFa,TAIFb,TAIFc,TAIFd
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGCTTCCCGAAGGTCCTCTCTGATGACATGAAGAAGCTGAAGGCCCGAATGGTAATGCTCCTCCCTACTTCTGCTCAGGGGTTGGGGGCCTGGGTCTCAGCGTGTGACACTGAGGACACTGTGGGACACCTGGGACCCTGGAGGGACAAGGATCCGGCCCTTTGGTGCCAACTCTGCCTCTCTTCACAGCACCAGGCCATAGAAAGATTTTATGATAAAATGCAAAATGCAGAATCAGGACGTGGACAGGTGATGTCGAGCCTGGCAGAGCTGGAGGACGACTTCAAAGAGGGCTACCTGGAGACAGTGGCGGCTTATTATGAGGAGCAGCACCCAGAGCTCACTCCTCTACTTGAAAAAGAAAGAGATGGATTACGGTGCCGAGGCAACAGATCCCCTGTCCCGGATGTTGAGGATCCCGCAACCGAGGAGCCTGGGGAGAGCTTTTGTGACAAGGTCATGAGATGGTTCCAGGCCATGCTGCAGCGGCTGCAGACCTGGTGGCACGGGGTTCTGGCCTGGGTGAAGGAGAAGGTGGTGGCCCTGGTCCATGCAGTGCAGGCCCTCTGGAAACAGTTCCAGAGTTTCTGCTGCTCTCTGTCAGAGCTCTTCATGTCCTCTTTCCAGTCCTACGGAGCCCCACGGGGGGACAAGGAGGAGCTGACACCCCAGAAGTGCTCTGAACCCCAATCCTCAAAATGA
ORF Protein Sequence MCFPKVLSDDMKKLKARMVMLLPTSAQGLGAWVSACDTEDTVGHLGPWRDKDPALWCQLCLSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T96028-Ab Anti-IL32/ IL-32alpha/ IL-32beta functional antibody
    Target Antigen GM-Tg-g-T96028-Ag IL32 protein
    ORF Viral Vector pGMLP000562 Human IL32 Lentivirus plasmid
    ORF Viral Vector pGMLP-IL-036 Human IL32 Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-119 Human IL32 Adenovirus plasmid
    ORF Viral Vector vGMLP000562 Human IL32 Lentivirus particle
    ORF Viral Vector vGMLP-IL-036 Human IL32 Lentivirus particle
    ORF Viral Vector vGMAP-IL-119 Human IL32 Adenovirus particle


    Target information

    Target ID GM-T96028
    Target Name IL-32/IL32
    Gene Group Identifier
    (Target Gene ID in Homo species)
    9235
    Gene ID 100065894 (Equus caballus), 102156096 (Canis lupus familiaris), 111556201 (Felis catus), 9235 (Homo sapiens)
    Gene Symbols & Synonyms IL32,NK4,TAIF,TAIFa,TAIFb,TAIFc,TAIFd,IL-32beta,IL-32alpha,IL-32delta,IL-32gamma
    Target Alternative Names IL-32,IL-32alpha,IL-32beta,IL-32delta,IL-32gamma,IL32,Interleukin-32,NK4,Natural killer cells protein 4,TAIF,TAIFa,TAIFb,TAIFc,TAIFd,Tumor necrosis factor alpha-inducing factor
    Uniprot Accession P24001
    Additional SwissProt Accessions: P24001
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG Cytokine-cytokine receptor interaction
    Gene Ensembl ENSECAG00000051569, ENSG00000008517
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.