Human TMEM187/CXorf12/DXS9878E ORF/cDNA clone-Lentivirus plasmid (NM_003492)

Cat. No.: pGMLP000564
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TMEM187/CXorf12/DXS9878E Lentiviral expression plasmid for TMEM187 lentivirus packaging, TMEM187 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to TMEM187/CXorf12 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $496.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000564
Gene Name TMEM187
Accession Number NM_003492
Gene ID 8269
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 786 bp
Gene Alias CXorf12,DXS9878E,ITBA1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAATCCAGAGTGGGGGCAGGCCTTCGTGCACGTGGCCGTGGCCGGTGGCCTCTGTGCCGTGGCTGTGTTCACGGGCATTTTCGACAGTGTTTCCGTGCAAGTGGGCTATGAGCACTACGCCGAGGCGCCCGTGGCCGGCCTCCCTGCCTTCCTGGCCATGCCGTTCAACTCACTCGTGAACATGGCCTACACGCTGCTGGGGCTGTCGTGGCTGCACAGGGGCGGCGCGATGGGGCTGGGTCCCCGCTACCTGAAGGACGTGTTCGCAGCCATGGCCCTGCTCTATGGCCCCGTGCAGTGGCTGCGCCTGTGGACGCAGTGGCGCCGTGCCGCGGTGCTGGACCAGTGGCTCACACTGCCCATCTTTGCATGGCCCGTGGCCTGGTGCCTCTACCTAGACCGCGGCTGGCGGCCCTGGCTGTTCCTCTCTCTTGAGTGCGTCTCCCTGGCCAGTTATGGCCTCGCTCTGCTGCATCCCCAGGGCTTCGAGGTCGCACTGGGTGCTCACGTGGTGGCCGCTGTGGGGCAGGCGCTGCGCACCCACAGGCACTATGGCAGCACCACCTCGGCTACCTACTTAGCTTTGGGGGTGCTCTCTTGCCTGGGCTTTGTGGTCCTCAAGCTGTGTGACCATCAGCTCGCACGGTGGCGTCTCTTCCAGTGCCTCACAGGCCACTTCTGGTCCAAGGTCTGTGACGTGCTCCAGTTCCACTTTGCGTTTTTGTTTCTGACGCATTTCAACACTCACCCAAGATTCCATCCCTCTGGCGGGAAGACGCGTTGA
ORF Protein Sequence MNPEWGQAFVHVAVAGGLCAVAVFTGIFDSVSVQVGYEHYAEAPVAGLPAFLAMPFNSLVNMAYTLLGLSWLHRGGAMGLGPRYLKDVFAAMALLYGPVQWLRLWTQWRRAAVLDQWLTLPIFAWPVAWCLYLDRGWRPWLFLSLECVSLASYGLALLHPQGFEVALGAHVVAAVGQALRTHRHYGSTTSATYLALGVLSCLGFVVLKLCDHQLARWRLFQCLTGHFWSKVCDVLQFHFAFLFLTHFNTHPRFHPSGGKTR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2028-Ab Anti-TMEM187 monoclonal antibody
    Target Antigen GM-Tg-g-IP2028-Ag TMEM187 protein
    ORF Viral Vector pGMLP000564 Human TMEM187 Lentivirus plasmid
    ORF Viral Vector vGMLP000564 Human TMEM187 Lentivirus particle


    Target information

    Target ID GM-IP2028
    Target Name TMEM187
    Gene Group Identifier
    (Target Gene ID in Homo species)
    8269
    Gene ID 100059186 (Equus caballus), 101090246 (Felis catus), 508380 (Bos taurus), 612536 (Canis lupus familiaris)
    698397 (Macaca mulatta), 8269 (Homo sapiens)
    Gene Symbols & Synonyms TMEM187,ITBA1,CXorf12,DXS9878E
    Target Alternative Names CXorf12,DXS9878E,ITBA1,Protein ITBA1,TMEM187,Transmembrane protein 187
    Uniprot Accession Q0VCM2,Q14656
    Additional SwissProt Accessions: Q0VCM2,Q14656
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000001086, ENSBTAG00000008278, ENSCAFG00845027090, ENSMMUG00000005132, ENSG00000177854
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.