Human TMEM187/CXorf12/DXS9878E ORF/cDNA clone-Lentivirus plasmid (NM_003492)
Cat. No.: pGMLP000564
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human TMEM187/CXorf12/DXS9878E Lentiviral expression plasmid for TMEM187 lentivirus packaging, TMEM187 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
TMEM187/CXorf12 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP000564 |
| Gene Name | TMEM187 |
| Accession Number | NM_003492 |
| Gene ID | 8269 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 786 bp |
| Gene Alias | CXorf12,DXS9878E,ITBA1 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAATCCAGAGTGGGGGCAGGCCTTCGTGCACGTGGCCGTGGCCGGTGGCCTCTGTGCCGTGGCTGTGTTCACGGGCATTTTCGACAGTGTTTCCGTGCAAGTGGGCTATGAGCACTACGCCGAGGCGCCCGTGGCCGGCCTCCCTGCCTTCCTGGCCATGCCGTTCAACTCACTCGTGAACATGGCCTACACGCTGCTGGGGCTGTCGTGGCTGCACAGGGGCGGCGCGATGGGGCTGGGTCCCCGCTACCTGAAGGACGTGTTCGCAGCCATGGCCCTGCTCTATGGCCCCGTGCAGTGGCTGCGCCTGTGGACGCAGTGGCGCCGTGCCGCGGTGCTGGACCAGTGGCTCACACTGCCCATCTTTGCATGGCCCGTGGCCTGGTGCCTCTACCTAGACCGCGGCTGGCGGCCCTGGCTGTTCCTCTCTCTTGAGTGCGTCTCCCTGGCCAGTTATGGCCTCGCTCTGCTGCATCCCCAGGGCTTCGAGGTCGCACTGGGTGCTCACGTGGTGGCCGCTGTGGGGCAGGCGCTGCGCACCCACAGGCACTATGGCAGCACCACCTCGGCTACCTACTTAGCTTTGGGGGTGCTCTCTTGCCTGGGCTTTGTGGTCCTCAAGCTGTGTGACCATCAGCTCGCACGGTGGCGTCTCTTCCAGTGCCTCACAGGCCACTTCTGGTCCAAGGTCTGTGACGTGCTCCAGTTCCACTTTGCGTTTTTGTTTCTGACGCATTTCAACACTCACCCAAGATTCCATCCCTCTGGCGGGAAGACGCGTTGA |
| ORF Protein Sequence | MNPEWGQAFVHVAVAGGLCAVAVFTGIFDSVSVQVGYEHYAEAPVAGLPAFLAMPFNSLVNMAYTLLGLSWLHRGGAMGLGPRYLKDVFAAMALLYGPVQWLRLWTQWRRAAVLDQWLTLPIFAWPVAWCLYLDRGWRPWLFLSLECVSLASYGLALLHPQGFEVALGAHVVAAVGQALRTHRHYGSTTSATYLALGVLSCLGFVVLKLCDHQLARWRLFQCLTGHFWSKVCDVLQFHFAFLFLTHFNTHPRFHPSGGKTR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP2028-Ab | Anti-TMEM187 monoclonal antibody |
| Target Antigen | GM-Tg-g-IP2028-Ag | TMEM187 protein |
| ORF Viral Vector | pGMLP000564 | Human TMEM187 Lentivirus plasmid |
| ORF Viral Vector | vGMLP000564 | Human TMEM187 Lentivirus particle |
Target information
| Target ID | GM-IP2028 |
| Target Name | TMEM187 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
8269 |
| Gene ID |
100059186 (Equus caballus), 101090246 (Felis catus), 508380 (Bos taurus), 612536 (Canis lupus familiaris) 698397 (Macaca mulatta), 8269 (Homo sapiens) |
| Gene Symbols & Synonyms | TMEM187,ITBA1,CXorf12,DXS9878E |
| Target Alternative Names | CXorf12,DXS9878E,ITBA1,Protein ITBA1,TMEM187,Transmembrane protein 187 |
| Uniprot Accession |
Q0VCM2,Q14656
Additional SwissProt Accessions: Q0VCM2,Q14656 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | |
| Disease | |
| Disease from KEGG | |
| Gene Ensembl | ENSECAG00000001086, ENSBTAG00000008278, ENSCAFG00845027090, ENSMMUG00000005132, ENSG00000177854 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


