Human GPR3/ACCA ORF/cDNA clone-Lentivirus plasmid (NM_005281)

Cat. No.: pGMLP000590
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GPR3/ACCA Lentiviral expression plasmid for GPR3 lentivirus packaging, GPR3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to GPR3/ACCA products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $548.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000590
Gene Name GPR3
Accession Number NM_005281
Gene ID 2827
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 993 bp
Gene Alias ACCA
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGATGTGGGGTGCAGGCAGCCCTCTGGCCTGGCTCTCAGCTGGCTCAGGCAACGTGAATGTAAGCAGCGTGGGCCCAGCAGAGGGGCCCACAGGTCCAGCCGCACCACTGCCCTCGCCTAAGGCCTGGGATGTGGTGCTCTGCATCTCAGGCACCCTGGTGTCCTGCGAGAATGCGCTAGTGGTGGCCATCATCGTGGGCACTCCTGCCTTCCGTGCCCCCATGTTCCTGCTGGTGGGCAGCCTGGCCGTGGCAGACCTGCTGGCAGGCCTGGGCCTGGTCCTGCACTTTGCTGCTGTCTTCTGCATCGGCTCAGCGGAGATGAGCCTGGTGCTGGTTGGCGTGCTGGCAATGGCCTTTACCGCCAGCATCGGCAGTCTACTGGCCATCACTGTCGACCGCTACCTTTCTCTGTACAATGCCCTCACCTACTATTCAGAGACAACAGTGACACGGACCTATGTGATGCTGGCCTTAGTGTGGGGAGGTGCCCTGGGCCTGGGGCTGCTGCCTGTGCTGGCCTGGAACTGCCTGGATGGCCTGACCACATGTGGCGTGGTTTATCCACTCTCCAAGAACCATCTGGTAGTTCTGGCCATTGCCTTCTTCATGGTGTTTGGCATCATGCTGCAGCTCTACGCCCAAATCTGCCGCATCGTCTGCCGCCATGCCCAGCAGATTGCCCTTCAGCGGCACCTGCTGCCTGCCTCCCACTATGTGGCCACCCGCAAGGGCATTGCCACACTGGCCGTGGTGCTTGGAGCCTTTGCCGCCTGCTGGTTGCCCTTCACTGTCTACTGCCTGCTGGGTGATGCCCACTCTCCACCTCTCTACACCTATCTTACCTTGCTCCCTGCCACCTACAACTCCATGATCAACCCTATCATCTACGCCTTCCGCAACCAGGATGTGCAGAAAGTGCTGTGGGCTGTCTGCTGCTGCTGTTCCTCTTCCAAGATCCCCTTCCGATCCCGCTCCCCCAGTGATGTCTAG
ORF Protein Sequence MMWGAGSPLAWLSAGSGNVNVSSVGPAEGPTGPAAPLPSPKAWDVVLCISGTLVSCENALVVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAAVFCIGSAEMSLVLVGVLAMAFTASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWGGALGLGLLPVLAWNCLDGLTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCRHAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDAHSPPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRSRSPSDV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T31227-Ab Anti-GPR3/ ACCA monoclonal antibody
    Target Antigen GM-Tg-g-T31227-Ag GPR3 VLP (virus-like particle)
    ORF Viral Vector pGMLP000590 Human GPR3 Lentivirus plasmid
    ORF Viral Vector vGMLP000590 Human GPR3 Lentivirus particle


    Target information

    Target ID GM-T31227
    Target Name GPR3
    Gene Group Identifier
    （Target Gene ID in Homo species)         		2827
    Gene ID 100070910 (Equus caballus), 101082583 (Felis catus), 14748 (Mus musculus), 266769 (Rattus norvegicus)
    2827 (Homo sapiens), 487344 (Canis lupus familiaris), 540687 (Bos taurus), 716033 (Macaca mulatta)
    Gene Symbols & Synonyms GPR3,Gpr3,Gpcr3,Gpcr20,Gpcr21,ACCA
    Target Alternative Names ACCA,ACCA orphan receptor,G-protein coupled receptor 3,GPR3,Gpcr20,Gpcr21,Gpcr3,Gpr3
    Uniprot Accession P35413,P46089,Q8K1Q3
    Additional SwissProt Accessions: P35413,Q8K1Q3,P46089
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000005510, ENSMUSG00000049649, ENSG00000181773, ENSCAFG00845010599, ENSBTAG00000002505, ENSMMUG00000018325
    Target Classification GPCR


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.