Human LIF/CDF/DIA ORF/cDNA clone-Lentivirus plasmid (NM_002309)

Cat. No.: pGMLP000884
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human LIF/CDF/DIA Lentiviral expression plasmid for LIF lentivirus packaging, LIF lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to LIF/CDF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $452.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000884
Gene Name LIF
Accession Number NM_002309
Gene ID 3976
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 609 bp
Gene Alias CDF,DIA,HILDA,MLPLI
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGGTCTTGGCGGCAGGAGTTGTGCCCCTGCTGTTGGTTCTGCACTGGAAACATGGGGCGGGGAGCCCCCTCCCCATCACCCCTGTCAACGCCACCTGTGCCATACGCCACCCATGTCACAACAACCTCATGAACCAGATCAGGAGCCAACTGGCACAGCTCAATGGCAGTGCCAATGCCCTCTTTATTCTCTATTACACAGCCCAGGGGGAGCCGTTCCCCAACAACCTGGACAAGCTATGTGGCCCCAACGTGACGGACTTCCCGCCCTTCCACGCCAACGGCACGGAGAAGGCCAAGCTGGTGGAGCTGTACCGCATAGTCGTGTACCTTGGCACCTCCCTGGGCAACATCACCCGGGACCAGAAGATCCTCAACCCCAGTGCCCTCAGCCTCCACAGCAAGCTCAACGCCACCGCCGACATCCTGCGAGGCCTCCTTAGCAACGTGCTGTGCCGCCTGTGCAGCAAGTACCACGTGGGCCATGTGGACGTGACCTACGGCCCTGACACCTCGGGTAAGGATGTCTTCCAGAAGAAGAAGCTGGGCTGTCAACTCCTGGGGAAGTATAAGCAGATCATCGCCGTGTTGGCCCAGGCCTTCTAG
ORF Protein Sequence MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T29774-Ab Anti-LIF/ CDF/ DIA functional antibody
    Target Antigen GM-Tg-g-T29774-Ag LIF protein
    Cytokine cks-Tg-g-GM-T29774 leukemia inhibitory factor (LIF) protein & antibody
    ORF Viral Vector pGMLP000884 Human LIF Lentivirus plasmid
    ORF Viral Vector vGMLP000884 Human LIF Lentivirus particle


    Target information

    Target ID GM-T29774
    Target Name LIF
    Gene Group Identifier
    （Target Gene ID in Homo species)         		3976
    Gene ID 100629131 (Equus caballus), 101090296 (Felis catus), 16878 (Mus musculus), 280840 (Bos taurus)
    3976 (Homo sapiens), 403449 (Canis lupus familiaris), 60584 (Rattus norvegicus), 715456 (Macaca mulatta)
    Gene Symbols & Synonyms LIF,Lif,CDF,DIA,HILDA,MLPLI
    Target Alternative Names CDF,DIA,Differentiation-stimulating factor (D factor),HILDA,LIF,Leukemia inhibitory factor,Lif,MLPLI,Melanoma-derived LPL inhibitor (MLPLI)
    Uniprot Accession P09056,P15018,P17777,Q27956
    Additional SwissProt Accessions: P09056,Q27956,P15018,P17777
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease cancer
    Disease from KEGG Cytokine-cytokine receptor interaction, Signaling pathways regulating pluripotency of stem cells, JAK-STAT signaling pathway, TNF signaling pathway
    Gene Ensembl ENSECAG00000030554, ENSMUSG00000034394, ENSBTAG00000007424, ENSG00000128342, ENSCAFG00845030902, ENSMMUG00000048630
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.