Human SFTPA1/COLEC4/PSAP ORF/cDNA clone-Lentivirus plasmid (NM_005411)

Cat. No.: pGMLP001846
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SFTPA1/COLEC4/PSAP Lentiviral expression plasmid for SFTPA1 lentivirus packaging, SFTPA1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to Surfactant Protein A/SFTPA1/SFTPA1/COLEC4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $486.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP001846
Gene Name SFTPA1
Accession Number NM_005411
Gene ID 653509
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 747 bp
Gene Alias COLEC4,PSAP,PSP-A,PSPA,SFTP1,SFTPA1B,SP-A,SP-A1,SPA,SPA1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGGCTGTGCCCTCTGGCCCTCAACCTCATCTTGATGGCAGCCTCTGGTGCTGTGTGCGAAGTGAAGGACGTTTGTGTTGGAAGCCCTGGTATCCCCGGCACTCCTGGATCCCACGGCCTGCCAGGCAGGGACGGGAGAGATGGTCTCAAAGGAGACCCTGGCCCTCCAGGCCCCATGGGTCCACCTGGAGAAATGCCATGTCCTCCTGGAAATGATGGGCTGCCTGGAGCCCCTGGTATCCCTGGAGAGTGTGGAGAGAAGGGGGAGCCTGGCGAGAGGGGCCCTCCAGGGCTTCCAGCTCATCTAGATGAGGAGCTCCAAGCCACACTCCACGACTTTAGACATCAAATCCTGCAGACAAGGGGAGCCCTCAGTCTGCAGGGCTCCATAATGACAGTAGGAGAGAAGGTCTTCTCCAGCAATGGGCAGTCCATCACTTTTGATGCCATTCAGGAGGCATGTGCCAGAGCAGGCGGCCGCATTGCTGTCCCAAGGAATCCAGAGGAAAATGAGGCCATTGCAAGCTTCGTGAAGAAGTACAACACATATGCCTATGTAGGCCTGACTGAGGGTCCCAGCCCTGGAGACTTCCGCTACTCAGACGGGACCCCTGTAAACTACACCAACTGGTACCGAGGGGAGCCCGCAGGTCGGGGAAAAGAGCAGTGTGTGGAGATGTACACAGATGGGCAGTGGAATGACAGGAACTGCCTGTACTCCCGACTGACCATCTGTGAGTTCTGA
ORF Protein Sequence MWLCPLALNLILMAASGAVCEVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1287-Ab Anti-SFTA1/ SFTPA1/ COLEC4 functional antibody
    Target Antigen GM-Tg-g-SE1287-Ag SFTPA1 protein
    ORF Viral Vector pGMLP001846 Human SFTPA1 Lentivirus plasmid
    ORF Viral Vector vGMLP001846 Human SFTPA1 Lentivirus particle


    Target information

    Target ID GM-SE1287
    Target Name Surfactant Protein A/SFTPA1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    653509
    Gene ID 653509 (Homo sapiens)
    Gene Symbols & Synonyms SFTPA1,SPA,ILD1,PSAP,PSPA,SP-A,SPA1,PSP-A,SFTP1,SP-A1,COLEC4,SFTPA1B,SP-A1 beta,SP-A1 delta,SP-A1 gamma,SP-A1 epsilon
    Target Alternative Names 35 kDa pulmonary surfactant-associated protein,Alveolar proteinosis protein,COLEC4,Collectin-4,ILD1,PSAP,PSP-A,PSPA,Pulmonary surfactant-associated protein A1,SFTP1,SFTPA1,SFTPA1B,SP-A,SP-A1,SP-A1 beta,SP-A1 delta,SP-A1 epsilon,SP-A1 gamma,SPA,SPA1,Surfactant Protein A
    Uniprot Accession Q8IWL2
    Additional SwissProt Accessions: Q8IWL2
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Diagnostics Biomarker
    Disease
    Disease from KEGG Phagosome, Pertussis
    Gene Ensembl ENSG00000122852
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.