Human RSPO1/CRISTIN3/RSPO ORF/cDNA clone-Lentivirus plasmid (NM_001242908)

Cat. No.: pGMLP003166
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RSPO1/CRISTIN3/RSPO Lentiviral expression plasmid for RSPO1 lentivirus packaging, RSPO1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to RSPO1/CRISTIN3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $498
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003166
Gene Name RSPO1
Accession Number NM_001242908
Gene ID 284654
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 792 bp
Gene Alias CRISTIN3,RSPO
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCGGCTTGGGCTGTGTGTGGTGGCCCTGGTTCTGAGCTGGACGCACCTCACCATCAGCAGCCGGGGGATCAAGGGGAAAAGGCAGAGGCGGATCAGTGCCGAGGGGAGCCAGGCCTGTGCCAAAGGCTGTGAGCTCTGCTCTGAAGTCAACGGCTGCCTCAAGTGCTCACCCAAGCTGTTCATCCTGCTGGAGAGGAACGACATCCGCCAGGTGGGCGTCTGCTTGCCGTCCTGCCCACCTGGATACTTCGACGCCCGCAACCCCGACATGAACAAGTGCATCAAATGCAAGATCGAGCACTGTGAGGCCTGCTTCAGCCATAACTTCTGCACCAAGTGTAAGGAGGGCTTGTACCTGCACAAGGGCCGCTGCTATCCAGCTTGTCCCGAGGGCTCCTCAGCTGCCAATGGCACCATGGAGTGCAGTAGTCCTGCGCAATGTGAAATGAGCGAGTGGTCTCCGTGGGGGCCCTGCTCCAAGAAGCAGCAGCTCTGTGGTTTCCGGAGGGGCTCCGAGGAGCGGACACGCAGGGTGCTACATGCCCCTGTGGGGGACCATGCTGCCTGCTCTGACACCAAGGAGACCCGGAGGTGCACAGTGAGGAGAGTGCCGTGTCCTGAGGGGCAGAAGAGGAGGAAGGGAGGCCAGGGCCGGCGGGAGAATGCCAACAGGAACCTGGCCAGGAAGGAGAGCAAGGAGGCGGGTGCTGGCTCTCGAAGACGCAAGGGGCAGCAACAGCAGCAGCAGCAAGGGACAGTGGGGCCACTCACATCTGCAGGGCCTGCCTAG
ORF Protein Sequence MRLGLCVVALVLSWTHLTISSRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T91023-Ab Anti-RSPO1/ CRISTIN3/ RSPO functional antibody
    Target Antigen GM-Tg-g-T91023-Ag RSPO1 protein
    ORF Viral Vector pGMLP003166 Human RSPO1 Lentivirus plasmid
    ORF Viral Vector pGMLV002698 Human RSPO1 Lentivirus plasmid
    ORF Viral Vector pGMAAV000008 Human RSPO1 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector vGMLP003166 Human RSPO1 Lentivirus particle
    ORF Viral Vector vGMLV002698 Human RSPO1 Lentivirus particle
    ORF Viral Vector vGMAAV000008 Human RSPO1 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-T91023
    Target Name RSPO1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    284654
    Gene ID 100054745 (Equus caballus), 101091033 (Felis catus), 192199 (Mus musculus), 284654 (Homo sapiens)
    313589 (Rattus norvegicus), 511675 (Bos taurus), 608179 (Canis lupus familiaris), 713976 (Macaca mulatta)
    Gene Symbols & Synonyms RSPO1,Rspo1,Rspondin,R-spondin,RSPO,CRISTIN3,RGD1565558
    Target Alternative Names CRISTIN3,R-spondin,R-spondin-1,RGD1565558,RSPO,RSPO1,Roof plate-specific spondin-1 (hRspo1),Rspo1,Rspondin
    Uniprot Accession Q2MKA7,Q9Z132
    Additional SwissProt Accessions: Q9Z132,Q2MKA7
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease
    Disease from KEGG Wnt signaling pathway
    Gene Ensembl ENSECAG00000022683, ENSMUSG00000028871, ENSG00000169218, ENSCAFG00845030653, ENSMMUG00000008420
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.