Human IL36G/IL-1F9/IL-1H1 ORF/cDNA clone-Lentivirus plasmid (NM_019618)
Cat. No.: pGMLP003211
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IL36G/IL-1F9/IL-1H1 Lentiviral expression plasmid for IL36G lentivirus packaging, IL36G lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
IL-36 Gamma/IL36G/IL36G/IL-1F9 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP003211 |
| Gene Name | IL36G |
| Accession Number | NM_019618 |
| Gene ID | 56300 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 510 bp |
| Gene Alias | IL-1F9,IL-1H1,IL-1RP2,IL1E,IL1F9,IL1H1,IL1RP2 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAGAGGCACTCCAGGAGACGCTGATGGTGGAGGAAGGGCCGTCTATCAATCAATGTGTAAACCTATTACTGGGACTATTAATGATTTGAATCAGCAAGTGTGGACCCTTCAGGGTCAGAACCTTGTGGCAGTTCCACGAAGTGACAGTGTGACCCCAGTCACTGTTGCTGTTATCACATGCAAGTATCCAGAGGCTCTTGAGCAAGGCAGAGGGGATCCCATTTATTTGGGAATCCAGAATCCAGAAATGTGTTTGTATTGTGAGAAGGTTGGAGAACAGCCCACATTGCAGCTAAAAGAGCAGAAGATCATGGATCTGTATGGCCAACCCGAGCCCGTGAAACCCTTCCTTTTCTACCGTGCCAAGACTGGTAGGACCTCCACCCTTGAGTCTGTGGCCTTCCCGGACTGGTTCATTGCCTCCTCCAAGAGAGACCAGCCCATCATTCTGACTTCAGAACTTGGGAAGTCATACAACACTGCCTTTGAATTAAATATAAATGACTGA |
| ORF Protein Sequence | MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T72514-Ab | Anti-IL36G/ IL-1F9/ IL-1H1 monoclonal antibody |
| Target Antigen | GM-Tg-g-T72514-Ag | IL36G VLP (virus-like particle) |
| Cytokine | cks-Tg-g-GM-T72514 | interleukin 36, gamma (IL36G) protein & antibody |
| ORF Viral Vector | pGMLP003211 | Human IL36G Lentivirus plasmid |
| ORF Viral Vector | pGMLP-IL-041 | Human IL36G Lentivirus plasmid |
| ORF Viral Vector | pGMAP-IL-124 | Human IL36G Adenovirus plasmid |
| ORF Viral Vector | vGMLP003211 | Human IL36G Lentivirus particle |
| ORF Viral Vector | vGMLP-IL-041 | Human IL36G Lentivirus particle |
| ORF Viral Vector | vGMAP-IL-124 | Human IL36G Adenovirus particle |
Target information
| Target ID | GM-T72514 |
| Target Name | IL-36 Gamma/IL36G |
|
Gene Group Identifier (Target Gene ID in Homo species) |
56300 |
| Gene ID |
100065031 (Equus caballus), 100686137 (Canis lupus familiaris), 101081377 (Felis catus), 215257 (Mus musculus) 499744 (Rattus norvegicus), 56300 (Homo sapiens), 615762 (Bos taurus), 700822 (Macaca mulatta) |
| Gene Symbols & Synonyms | IL36G,Il36g,If36g,Il1f9,IL-36gamma,RGD1563019,IL1E,IL1F9,IL1H1,IL-1F9,IL-1H1,IL1RP2,IL-1RP2 |
| Target Alternative Names | IL-1-related protein 2 (IL-1RP2),IL-1F9,IL-1H1,IL-1RP2,IL-36 Gamma,IL-36gamma,IL1E,IL1F9,IL1H1,IL1RP2,IL36G,If36g,Il1f9,Il36g,Interleukin-1 epsilon (IL-1 epsilon),Interleukin-1 family member 9 (IL-1F9),Interleukin-1 homolog 1 (IL-1H1),Interleukin-36 gamma,RGD1563019 |
| Uniprot Accession |
Q8R460,Q9NZH8
Additional SwissProt Accessions: Q8R460,Q9NZH8 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, Cytokine Target |
| Disease | |
| Disease from KEGG | Cytokine-cytokine receptor interaction |
| Gene Ensembl | ENSECAG00000059103, ENSCAFG00845011516, ENSMUSG00000044103, ENSG00000136688, ENSBTAG00000002085, ENSMMUG00000062948 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


