Human REG4/GISP/REG-IV ORF/cDNA clone-Lentivirus plasmid (NM_032044)

Cat. No.: pGMLP004216
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human REG4/GISP/REG-IV Lentiviral expression plasmid for REG4 lentivirus packaging, REG4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to REG4/GISP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004216
Gene Name REG4
Accession Number NM_032044
Gene ID 83998
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 477 bp
Gene Alias GISP,REG-IV,RELP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTTCCAGAAGCATGCGGCTGCTCCTATTGCTGAGCTGCCTGGCCAAAACAGGAGTCCTGGGTGATATCATCATGAGACCCAGCTGTGCTCCTGGATGGTTTTACCACAAGTCCAATTGCTATGGTTACTTCAGGAAGCTGAGGAACTGGTCTGATGCCGAGCTCGAGTGTCAGTCTTACGGAAACGGAGCCCACCTGGCATCTATCCTGAGTTTAAAGGAAGCCAGCACCATAGCAGAGTACATAAGTGGCTATCAGAGAAGCCAGCCGATATGGATTGGCCTGCACGACCCACAGAAGAGGCAGCAGTGGCAGTGGATTGATGGGGCCATGTATCTGTACAGATCCTGGTCTGGCAAGTCCATGGGTGGGAACAAGCACTGTGCTGAGATGAGCTCCAATAACAACTTTTTAACTTGGAGCAGCAACGAATGCAACAAGCGCCAACACTTCCTGTGCAAGTACCGACCATAG
ORF Protein Sequence MASRSMRLLLLLSCLAKTGVLGDIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T94532-Ab Anti-REG4/ GISP/ REG-IV functional antibody
    Target Antigen GM-Tg-g-T94532-Ag REG4 protein
    ORF Viral Vector pGMLP004216 Human REG4 Lentivirus plasmid
    ORF Viral Vector vGMLP004216 Human REG4 Lentivirus particle


    Target information

    Target ID GM-T94532
    Target Name REG4
    Gene Group Identifier
    (Target Gene ID in Homo species)
    83998
    Gene ID 101091547 (Felis catus), 111773658 (Equus caballus), 445583 (Rattus norvegicus), 67709 (Mus musculus)
    695966 (Macaca mulatta), 767907 (Bos taurus), 83998 (Homo sapiens)
    Gene Symbols & Synonyms REG4,Reg4,NBPF8,GISP,RELP,2010002L15Rik,REG-IV
    Target Alternative Names 2010002L15Rik,GISP,Gastrointestinal secretory protein,NBPF8,REG-4,REG-IV,REG-like protein,REG4,RELP,Reg4,Regenerating islet-derived protein 4,Regenerating islet-derived protein IV (Reg IV)
    Uniprot Accession Q68AX7,Q9BYZ8,Q9D8G5
    Additional SwissProt Accessions: Q68AX7,Q9D8G5,Q9BYZ8
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG Gastric cancer
    Gene Ensembl ENSMUSG00000027876, ENSMMUG00000060387, ENSBTAG00000032193, ENSG00000134193
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.