Human TFF3/ITF/P1B ORF/cDNA clone-Lentivirus plasmid (NM_003226)

Cat. No.: pGMLP004527
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TFF3/ITF/P1B Lentiviral expression plasmid for TFF3 lentivirus packaging, TFF3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to Trefoil factor 3/TFF3/TFF3/ITF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004527
Gene Name TFF3
Accession Number NM_003226
Gene ID 7033
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 285 bp
Gene Alias ITF,P1B,TFI
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTGCCAGAGCGCTCTGCATGCTGGGGCTGGTCCTGGCCTTGCTGTCCTCCAGCTCTGCTGAGGAGTACGTGGGCCTGTCTGCAAACCAGTGTGCCGTGCCAGCCAAGGACAGGGTGGACTGCGGCTACCCCCATGTCACCCCCAAGGAGTGCAACAACCGGGGCTGCTGCTTTGACTCCAGGATCCCTGGAGTGCCTTGGTGTTTCAAGCCCCTGCAGGAAGCAGAATGCACCTTCTGA
ORF Protein Sequence MAARALCMLGLVLALLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1334-Ab Anti-TFF3/ ITF/ P1B functional antibody
    Target Antigen GM-Tg-g-SE1334-Ag TFF3 protein
    ORF Viral Vector pGMLP004527 Human TFF3 Lentivirus plasmid
    ORF Viral Vector pGMLV002284 Human TFF3 Lentivirus plasmid
    ORF Viral Vector vGMLP004527 Human TFF3 Lentivirus particle
    ORF Viral Vector vGMLV002284 Human TFF3 Lentivirus particle


    Target information

    Target ID GM-SE1334
    Target Name Trefoil factor 3/TFF3
    Gene Group Identifier
    （Target Gene ID in Homo species)         		7033
    Gene ID 100058018 (Equus caballus), 100170655 (Felis catus), 21786 (Mus musculus), 25563 (Rattus norvegicus)
    403488 (Canis lupus familiaris), 517889 (Bos taurus), 7033 (Homo sapiens), 722463 (Macaca mulatta)
    Gene Symbols & Synonyms TFF3,Tff3,ITF,mITF,P1B,TFI
    Target Alternative Names ITF,Intestinal trefoil factor (hITF),P1B,Polypeptide P1.B (hP1.B),TFF3,TFI,Tff3,Trefoil factor 3,mITF
    Uniprot Accession A8YXX7,B4X8D9,Q03191,Q07654,Q62395,Q863B4
    Additional SwissProt Accessions: B4X8D9,Q62395,Q03191,Q863B4,A8YXX7,Q07654
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Diagnostics Biomarker
    Disease cancer, Prostate Cancer, Kidney failure
    Disease from KEGG
    Gene Ensembl ENSECAG00000015204, ENSMUSG00000024029, ENSCAFG00845030487, ENSBTAG00000021276, ENSG00000160180, ENSMMUG00000062860
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.