Human EFNA2/ELF-1/EPLG6 ORF/cDNA clone-Lentivirus plasmid (NM_001405)

Cat. No.: pGMLP004638
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human EFNA2/ELF-1/EPLG6 Lentiviral expression plasmid for EFNA2 lentivirus packaging, EFNA2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to EFNA2/ELF-1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $460.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004638
Gene Name EFNA2
Accession Number NM_001405
Gene ID 1943
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 642 bp
Gene Alias ELF-1,EPLG6,HEK7-L,LERK-6,LERK6
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGCCCGCGCAGCGCCCGCTGCTCCCGCTGCTGCTCCTGCTGTTACCGCTGCCGCCGCCGCCCTTCGCGCGCGCCGAGGACGCCGCCCGCGCCAACTCGGACCGCTACGCCGTCTACTGGAACCGCAGCAACCCCAGGTTCCACGCAGGCGCGGGGGACGACGGCGGGGGCTACACGGTGGAGGTGAGCATCAATGACTACCTGGACATCTACTGCCCGCACTATGGGGCGCCGCTGCCGCCGGCCGAGCGCATGGAGCACTACGTGCTGTACATGGTCAACGGCGAGGGCCACGCCTCCTGCGACCACCGCCAGCGCGGCTTCAAGCGCTGGGAGTGCAACCGGCCCGCGGCGCCCGGGGGGCCGCTCAAGTTCTCGGAGAAGTTCCAGCTCTTCACGCCCTTCTCCCTGGGCTTCGAGTTCCGGCCCGGCCACGAGTATTACTACATCTCTGCCACGCCTCCCAATGCTGTGGACCGGCCCTGCCTGCGACTGAAGGTGTACGTGCGGCCGACCAACGAGACCCTGTACGAGGCTCCTGAGCCCATCTTCACCAGCAATAACTCGTGTAGCAGCCCGGGCGGCTGCCGCCTCTTCCTCAGCACCATCCCCGTGCTCTGGACCCTCCTGGGTTCCTAG
ORF Protein Sequence MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLGS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0393-Ab Anti-EFNA2/ ELF-1/ EPLG6 monoclonal antibody
    Target Antigen GM-Tg-g-MP0393-Ag EFNA2 VLP (virus-like particle)
    ORF Viral Vector pGMLP004638 Human EFNA2 Lentivirus plasmid
    ORF Viral Vector vGMLP004638 Human EFNA2 Lentivirus particle


    Target information

    Target ID GM-MP0393
    Target Name EFNA2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    1943
    Gene ID 111557556 (Felis catus), 111774429 (Equus caballus), 119864601 (Canis lupus familiaris), 13637 (Mus musculus)
    1943 (Homo sapiens), 614453 (Bos taurus), 721231 (Macaca mulatta), 84358 (Rattus norvegicus)
    Gene Symbols & Synonyms EFNA2,Efna2,Elf1,Epl6,CEK7L,Eplg6,Lerk6,ELF-1,EPLG6,LERK6,HEK7-L,LERK-6
    Target Alternative Names CEK7L,EFNA2,ELF-1,EPH-related receptor tyrosine kinase ligand 6 (LERK-6),EPLG6,Efna2,Elf1,Ephrin-A2,Epl6,Eplg6,HEK7 ligand (HEK7-L),HEK7-L,LERK-6,LERK6,Lerk6
    Uniprot Accession O43921,P52801
    Additional SwissProt Accessions: P52801,O43921
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, PI3K-Akt signaling pathway, Axon guidance
    Gene Ensembl ENSECAG00000036611, ENSCAFG00845012831, ENSMUSG00000003070, ENSG00000099617, ENSBTAG00000038221, ENSMMUG00000051284
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.