Human EFNA2/ELF-1/EPLG6 ORF/cDNA clone-Lentivirus plasmid (NM_001405)
Cat. No.: pGMLP004638
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human EFNA2/ELF-1/EPLG6 Lentiviral expression plasmid for EFNA2 lentivirus packaging, EFNA2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
EFNA2/ELF-1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP004638 |
| Gene Name | EFNA2 |
| Accession Number | NM_001405 |
| Gene ID | 1943 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 642 bp |
| Gene Alias | ELF-1,EPLG6,HEK7-L,LERK-6,LERK6 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCGCCCGCGCAGCGCCCGCTGCTCCCGCTGCTGCTCCTGCTGTTACCGCTGCCGCCGCCGCCCTTCGCGCGCGCCGAGGACGCCGCCCGCGCCAACTCGGACCGCTACGCCGTCTACTGGAACCGCAGCAACCCCAGGTTCCACGCAGGCGCGGGGGACGACGGCGGGGGCTACACGGTGGAGGTGAGCATCAATGACTACCTGGACATCTACTGCCCGCACTATGGGGCGCCGCTGCCGCCGGCCGAGCGCATGGAGCACTACGTGCTGTACATGGTCAACGGCGAGGGCCACGCCTCCTGCGACCACCGCCAGCGCGGCTTCAAGCGCTGGGAGTGCAACCGGCCCGCGGCGCCCGGGGGGCCGCTCAAGTTCTCGGAGAAGTTCCAGCTCTTCACGCCCTTCTCCCTGGGCTTCGAGTTCCGGCCCGGCCACGAGTATTACTACATCTCTGCCACGCCTCCCAATGCTGTGGACCGGCCCTGCCTGCGACTGAAGGTGTACGTGCGGCCGACCAACGAGACCCTGTACGAGGCTCCTGAGCCCATCTTCACCAGCAATAACTCGTGTAGCAGCCCGGGCGGCTGCCGCCTCTTCCTCAGCACCATCCCCGTGCTCTGGACCCTCCTGGGTTCCTAG |
| ORF Protein Sequence | MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLGS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-MP0393-Ab | Anti-EFNA2/ ELF-1/ EPLG6 monoclonal antibody |
| Target Antigen | GM-Tg-g-MP0393-Ag | EFNA2 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP004638 | Human EFNA2 Lentivirus plasmid |
| ORF Viral Vector | vGMLP004638 | Human EFNA2 Lentivirus particle |
Target information
| Target ID | GM-MP0393 |
| Target Name | EFNA2 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
1943 |
| Gene ID |
111557556 (Felis catus), 111774429 (Equus caballus), 119864601 (Canis lupus familiaris), 13637 (Mus musculus) 1943 (Homo sapiens), 614453 (Bos taurus), 721231 (Macaca mulatta), 84358 (Rattus norvegicus) |
| Gene Symbols & Synonyms | EFNA2,Efna2,Elf1,Epl6,CEK7L,Eplg6,Lerk6,ELF-1,EPLG6,LERK6,HEK7-L,LERK-6 |
| Target Alternative Names | CEK7L,EFNA2,ELF-1,EPH-related receptor tyrosine kinase ligand 6 (LERK-6),EPLG6,Efna2,Elf1,Ephrin-A2,Epl6,Eplg6,HEK7 ligand (HEK7-L),HEK7-L,LERK-6,LERK6,Lerk6 |
| Uniprot Accession |
O43921,P52801
Additional SwissProt Accessions: P52801,O43921 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | |
| Disease | |
| Disease from KEGG | MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, PI3K-Akt signaling pathway, Axon guidance |
| Gene Ensembl | ENSECAG00000036611, ENSCAFG00845012831, ENSMUSG00000003070, ENSG00000099617, ENSBTAG00000038221, ENSMMUG00000051284 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


