Human SUMO1/DAP1/GMP1 ORF/cDNA clone-Lentivirus plasmid (NM_003352)

Cat. No.: pGMLP000463
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SUMO1/DAP1/GMP1 Lentiviral expression plasmid for SUMO1 lentivirus packaging, SUMO1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to SUMO1/DAP1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000463
Gene Name SUMO1
Accession Number NM_003352
Gene ID 7341
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 306 bp
Gene Alias DAP1,GMP1,OFC10,PIC1,SENP2,SMT3,SMT3C,SMT3H3,UBL1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCTGACCAGGAGGCAAAACCTTCAACTGAGGACTTGGGGGATAAGAAGGAAGGTGAATATATTAAACTCAAAGTCATTGGACAGGATAGCAGTGAGATTCACTTCAAAGTGAAAATGACAACACATCTCAAGAAACTCAAAGAATCATACTGTCAAAGACAGGGTGTTCCAATGAATTCACTCAGGTTTCTCTTTGAGGGTCAGAGAATTGCTGATAATCATACTCCAAAAGAACTGGGAATGGAGGAAGAAGATGTGATTGAAGTTTATCAGGAACAAACGGGGGGTCATTCAACAGTTTAG
ORF Protein Sequence MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-TA023-Ab Anti-SUMO1 monoclonal antibody
    Target Antigen GM-Tg-g-TA023-Ag SUMO1 protein
    ORF Viral Vector pGMLP000463 Human SUMO1 Lentivirus plasmid
    ORF Viral Vector pGMAP000313 Human SUMO1 Adenovirus plasmid
    ORF Viral Vector pGMPC000059 Human SUMO1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001223 Human SUMO1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001826 Human SUMO1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001862 Human SUMO1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000463 Human SUMO1 Lentivirus particle
    ORF Viral Vector vGMAP000313 Human SUMO1 Adenovirus particle


    Target information

    Target ID GM-TA023
    Target Name SUMO1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		7341
    Gene ID 100067107 (Equus caballus), 101095673 (Felis catus), 22218 (Mus musculus), 301442 (Rattus norvegicus)
    478874 (Canis lupus familiaris), 614967 (Bos taurus), 703644 (Macaca mulatta), 7341 (Homo sapiens)
    Gene Symbols & Synonyms SUMO1,Sumo1,GMP1,PIC1,SMT3,Ubl1,SMTP3,Smt3C,SMT3H3,SUMO-1,SENTRIN,DAP1,UBL1,OFC10,SENP2,SMT3C
    Target Alternative Names DAP1,GAP-modifying protein 1 (GMP1),GMP1,OFC10,PIC1,SENP2,SENTRIN,SMT3,SMT3 homolog 3,SMT3C,SMT3H3,SMTP3,SUMO-1,SUMO1,Sentrin,Small ubiquitin-related modifier 1,Smt3C,Sumo1,UBL1,Ubiquitin-homology domain protein PIC1,Ubiquitin-like protein SMT3C (Smt3C),Ubiquitin-like protein UBL1,Ubl1
    Uniprot Accession P63165,P63166,Q5E9D1,Q5I0H3
    Additional SwissProt Accessions: P63166,Q5I0H3,Q5E9D1,P63165
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG Fluid shear stress and atherosclerosis
    Gene Ensembl ENSMUSG00000026021, ENSMMUG00000005240, ENSG00000116030
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.