Human KLK3/APS/hK3 ORF/cDNA clone-Lentivirus plasmid (NM_001648)

Cat. No.: pGMLP000533
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human KLK3/APS/hK3 Lentiviral expression plasmid for KLK3 lentivirus packaging, KLK3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to KLK3/PSA/KLK3/APS products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $496.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000533
Gene Name KLK3
Accession Number NM_001648
Gene ID 354
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 786 bp
Gene Alias APS,hK3,KLK2A1,PSA
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGGGTCCCGGTTGTCTTCCTCACCCTGTCCGTGACGTGGATTGGTGCTGCACCCCTCATCCTGTCTCGGATTGTGGGAGGCTGGGAGTGCGAGAAGCATTCCCAACCCTGGCAGGTGCTTGTGGCCTCTCGTGGCAGGGCAGTCTGCGGCGGTGTTCTGGTGCACCCCCAGTGGGTCCTCACAGCTGCCCACTGCATCAGGAACAAAAGCGTGATCTTGCTGGGTCGGCACAGCCTGTTTCATCCTGAAGACACAGGCCAGGTATTTCAGGTCAGCCACAGCTTCCCACACCCGCTCTACGATATGAGCCTCCTGAAGAATCGATTCCTCAGGCCAGGTGATGACTCCAGCCACGACCTCATGCTGCTCCGCCTGTCAGAGCCTGCCGAGCTCACGGATGCTGTGAAGGTCATGGACCTGCCCACCCAGGAGCCAGCACTGGGGACCACCTGCTACGCCTCAGGCTGGGGCAGCATTGAACCAGAGGAGTTCTTGACCCCAAAGAAACTTCAGTGTGTGGACCTCCATGTTATTTCCAATGACGTGTGTGCGCAAGTTCACCCTCAGAAGGTGACCAAGTTCATGCTGTGTGCTGGACGCTGGACAGGGGGCAAAAGCACCTGCTCGGGTGATTCTGGGGGCCCACTTGTCTGTAATGGTGTGCTTCAAGGTATCACGTCATGGGGCAGTGAACCATGTGCCCTGCCCGAAAGGCCTTCCCTGTACACCAAGGTGGTGCATTACCGGAAGTGGATCAAGGACACCATCGTGGCCAACCCCTGA
ORF Protein Sequence MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T36935-Ab Anti-KLK3/ APS/ KLK2A1 functional antibody
    Target Antigen GM-Tg-g-T36935-Ag KLK3 protein
    ORF Viral Vector pGMLP000533 Human KLK3 Lentivirus plasmid
    ORF Viral Vector pGMAP000060 Human KLK3 Adenovirus plasmid
    ORF Viral Vector pGMAP000250 Human KLK3 Adenovirus plasmid
    ORF Viral Vector vGMLP000533 Human KLK3 Lentivirus particle
    ORF Viral Vector vGMAP000060 Human KLK3 Adenovirus particle
    ORF Viral Vector vGMAP000250 Human KLK3 Adenovirus particle


    Target information

    Target ID GM-T36935
    Target Name KLK3/PSA
    Gene Group Identifier
    （Target Gene ID in Homo species)         		354
    Gene ID 354 (Homo sapiens)
    Gene Symbols & Synonyms KLK3,APS,PSA,hK3,KLK2A1
    Target Alternative Names APS,Gamma-seminoprotein (Seminin),KLK2A1,KLK3,Kallikrein-3,P-30 antigen,PSA,Prostate-specific antigen,Semenogelase,hK3
    Uniprot Accession P07288
    Additional SwissProt Accessions: P07288
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Immuno-oncology Target
    Disease cancer, Prostate Cancer, Malignant neoplasm of prostate
    Disease from KEGG Pathways in cancer, Prostate cancer
    Gene Ensembl ENSG00000142515
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.