Human YWHAQ/14-3-3/1C5 ORF/cDNA clone-Lentivirus plasmid (NM_006826)

Cat. No.: pGMLP000536
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human YWHAQ/14-3-3/1C5 Lentiviral expression plasmid for YWHAQ lentivirus packaging, YWHAQ lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to 41701/YWHAQ/YWHAQ/14-3-3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $484.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000536
Gene Name YWHAQ
Accession Number NM_006826
Gene ID 10971
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 738 bp
Gene Alias 14-3-3,1C5,HS1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGAAGACTGAGCTGATCCAGAAGGCCAAGCTGGCCGAGCAGGCCGAGCGCTACGACGACATGGCCACCTGCATGAAGGCAGTGACCGAGCAGGGCGCCGAGCTGTCCAACGAGGAGCGCAACCTGCTCTCCGTGGCCTACAAGAACGTGGTCGGGGGCCGCAGGTCCGCCTGGAGGGTCATCTCTAGCATCGAGCAGAAGACCGACACCTCCGACAAGAAGTTGCAGCTGATTAAGGACTATCGGGAGAAAGTGGAGTCCGAGCTGAGATCCATCTGCACCACGGTGCTGGAATTGTTGGATAAATATTTAATAGCCAATGCAACTAATCCAGAGAGTAAGGTCTTCTATCTGAAAATGAAGGGTGATTACTTCCGGTACCTTGCTGAAGTTGCGTGTGGTGATGATCGAAAACAAACGATAGATAATTCCCAAGGAGCTTACCAAGAGGCATTTGATATAAGCAAGAAAGAGATGCAACCCACACACCCAATCCGCCTGGGGCTTGCTCTTAACTTTTCTGTATTTTACTATGAGATTCTTAATAACCCAGAGCTTGCCTGCACGCTGGCTAAAACGGCTTTTGATGAGGCCATTGCTGAACTTGATACACTGAATGAAGACTCATACAAAGACAGCACCCTCATCATGCAGTTGCTTAGAGACAACCTAACACTTTGGACATCAGACAGTGCAGGAGAAGAATGTGATGCGGCAGAAGGGGCTGAAAACTAA
ORF Protein Sequence MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2293-Ab Anti-YWHAQ monoclonal antibody
    Target Antigen GM-Tg-g-IP2293-Ag YWHAQ protein
    ORF Viral Vector pGMLP000536 Human YWHAQ Lentivirus plasmid
    ORF Viral Vector pGMAP000259 Human YWHAQ Adenovirus plasmid
    ORF Viral Vector vGMLP000536 Human YWHAQ Lentivirus particle
    ORF Viral Vector vGMAP000259 Human YWHAQ Adenovirus particle


    Target information

    Target ID GM-IP2293
    Target Name 41701/YWHAQ
    Gene Group Identifier
    (Target Gene ID in Homo species)
    10971
    Gene ID 100057123 (Equus caballus), 101088481 (Felis catus), 10971 (Homo sapiens), 22630 (Mus musculus)
    25577 (Rattus norvegicus), 607060 (Canis lupus familiaris), 694702 (Macaca mulatta), 768311 (Bos taurus)
    Gene Symbols & Synonyms YWHAQ,Ywhaq,1C5,HS1,14-3-3,2700028P07Rik,14-3-3t
    Target Alternative Names 14-3-3,14-3-3 protein T-cell,14-3-3 protein tau,14-3-3 protein theta,14-3-3t,1C5,2700028P07Rik,41701,HS1,Protein HS1,YWHAQ,Ywhaq
    Uniprot Accession P27348,P68254,P68255,Q3SZI4
    Additional SwissProt Accessions: P27348,P68254,P68255,Q3SZI4
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease Lung Cancer
    Disease from KEGG PI3K-Akt signaling pathway, Hippo signaling pathway, Hepatitis C, Hepatitis B
    Gene Ensembl ENSECAG00000004925, ENSG00000134308, ENSMUSG00000076432, ENSCAFG00845025457, ENSMMUG00000006965, ENSBTAG00000002108
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.