Human SUMO1/DAP1/GMP1 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_003352.8)
Cat. No.: pGMPC001826
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human SUMO1/DAP1/GMP1 Non-Viral expression plasmid (overexpression vector) for mouse SUMO1 overexpression in unique cell transient transfection and stable cell line development.
Go to
SUMO1/DAP1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMPC001826 |
| Gene Name | SUMO1 |
| Accession Number | NM_003352.8 |
| Gene ID | 7341 |
| Species | Human |
| Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
| Insert Length | 306 bp |
| Gene Alias | DAP1,GMP1,OFC10,PIC1,SENP2,SMT3,SMT3C,SMT3H3,UBL1 |
| Fluorescent Reporter | Null |
| Mammalian Cell Selection | Null |
| Fusion Tag | HA (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTCTGACCAGGAGGCAAAACCTTCAACTGAGGACTTGGGGGATAAGAAGGAAGGTGAATATATTAAACTCAAAGTCATTGGACAGGATAGCAGTGAGATTCACTTCAAAGTGAAAATGACAACACATCTCAAGAAACTCAAAGAATCATACTGTCAAAGACAGGGTGTTCCAATGAATTCACTCAGGTTTCTCTTTGAGGGTCAGAGAATTGCTGATAATCATACTCCAAAAGAACTGGGAATGGAGGAAGAAGATGTGATTGAAGTTTATCAGGAACAAACGGGGGGTCATTCAACAGTTTAG |
| ORF Protein Sequence | MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-TA023-Ab | Anti-SUMO1 monoclonal antibody |
| Target Antigen | GM-Tg-g-TA023-Ag | SUMO1 protein |
| ORF Viral Vector | pGMLP000463 | Human SUMO1 Lentivirus plasmid |
| ORF Viral Vector | pGMAP000313 | Human SUMO1 Adenovirus plasmid |
| ORF Viral Vector | pGMPC000059 | Human SUMO1 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | pGMPC001223 | Human SUMO1 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | pGMPC001826 | Human SUMO1 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | pGMPC001862 | Human SUMO1 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP000463 | Human SUMO1 Lentivirus particle |
| ORF Viral Vector | vGMAP000313 | Human SUMO1 Adenovirus particle |
Target information
| Target ID | GM-TA023 |
| Target Name | SUMO1 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
7341 |
| Gene ID |
100067107 (Equus caballus), 101095673 (Felis catus), 22218 (Mus musculus), 301442 (Rattus norvegicus) 478874 (Canis lupus familiaris), 614967 (Bos taurus), 703644 (Macaca mulatta), 7341 (Homo sapiens) |
| Gene Symbols & Synonyms | SUMO1,Sumo1,GMP1,PIC1,SMT3,Ubl1,SMTP3,Smt3C,SMT3H3,SUMO-1,SENTRIN,DAP1,UBL1,OFC10,SENP2,SMT3C |
| Target Alternative Names | DAP1,GAP-modifying protein 1 (GMP1),GMP1,OFC10,PIC1,SENP2,SENTRIN,SMT3,SMT3 homolog 3,SMT3C,SMT3H3,SMTP3,SUMO-1,SUMO1,Sentrin,Small ubiquitin-related modifier 1,Smt3C,Sumo1,UBL1,Ubiquitin-homology domain protein PIC1,Ubiquitin-like protein SMT3C (Smt3C),Ubiquitin-like protein UBL1,Ubl1 |
| Uniprot Accession |
P63165,P63166,Q5E9D1,Q5I0H3
Additional SwissProt Accessions: P63166,Q5I0H3,Q5E9D1,P63165 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | cancer |
| Disease from KEGG | Fluid shear stress and atherosclerosis |
| Gene Ensembl | ENSMUSG00000026021, ENSMMUG00000005240, ENSG00000116030 |
| Target Classification | Tumor-associated antigen (TAA) |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


